Recombinant human ARNTL2 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Species
human
Cat no : Ag15082
Synonyms
BMAL2; CLIF; MGC149671; MGC149672; MOP9; PASD9; bHLHe6
Validation Data Gallery View All
Product Information
| Peptide Sequence |
RQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
(438-626 aa encoded by BC000172) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
