Recombinant human ARID4B protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Species
human
Cat no : Ag21462
Synonyms
BCAA; BRCAA1; DKFZp313M2420; MGC163290; RBBP1L1; RBP1L1; SAP180
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE
(406-523 aa encoded by BC130418) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
