Recombinant human APOE protein
Cat no : Ag13070
Synonyms
APOE, Apo E, Apo-E, apoe4, apolipoprotein E
Validation Data Gallery View All
Product Information
| Peptide Sequence |
AKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFE
(18-284 aa encoded by BC003557) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
F1000Res Identification of high-performing antibodies for Apolipoprotein E for use in Western Blot and immunoprecipitation |
