Recombinant human MMP14 protein
Cat no : Ag6062
Synonyms
MMP14, EC:3.4.24.80, Matrix metalloproteinase 14, Matrix metalloproteinase-14, Membrane-type matrix metalloproteinase 1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM
(1-350 aa encoded by BC064803) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Cancer Sci Miniaturized antibodies for imaging membrane type-1 matrix metalloproteinase in cancers. |
