Recombinant human BAX protein
Cat no : Ag21068
Synonyms
BAX, Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4, Apoptosis
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
(1-192 aa encoded by BC014175) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Phys Chem Chem Phys Single-molecule scale quantification reveals interactions underlying protein-protein interface: from forces to non-covalent bonds. |
