Recombinant human DRD1 protein
Cat no : Ag12366
Synonyms
DRD1, D(1A) dopamine receptor, DADR, Dopamine D1 receptor, dopamine receptor D1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
(338-446 aa encoded by BC074978) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Elife The organic cation transporter 2 regulates dopamine D1 receptor signaling at the Golgi apparatus. |
