Recombinant human IFITM1 protein
Cat no : Ag2320
Synonyms
9-27; CD225; IFI17; LEU13
Validation Data Gallery View All
Product Information
Peptide Sequence |
MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
(1-125 aa encoded by BC000897) |
Activity | Not tested. |
Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
Species | Title |
---|---|
Antiviral Res Spike-mediated viral membrane fusion is inhibited by a specific anti-IFITM2 monoclonal antibody |