ESR2 Fusion Protein

Catalog number: Ag5103

Product Name:
human ESR2-GST fusion protein

Catalog No:
Ag5103

Source:
e coli.-derived, PGEX-4T

Peptide Sequence:
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
(1-323 aa encoded by BC024181)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay.

Back
to top