Cytochrome c Fusion Protein

Catalog number: Ag1455

Product Name:
human CYCS-GST fusion protein

Catalog No:
Ag1455

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
(1-105 aa encoded by BC009578)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top