Recombinant human Cytochrome c protein
Cat no : Ag1455
Synonyms
Cytochrome c, CYC, CYCS
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
(1-105 aa encoded by BC009578) |
| Activity | Not tested. |
| Endotoxin Level |
Please contact the lab for more information.
Note:Remove endotoxin and sterilization is required for cell assay. |
Publications
| Species | Title |
|---|---|
Mol Cell Endocrinol Glucose deprivation impairs lipid tolerance related to mitophagy disorder in cardiomyocytes. |
