4921513D23Rik Fusion Protein

Catalog number: Ag13709
  • Print page
  • Download PDF

Product Name:
mouse 4921513D23Rik-GST fusion protein

Catalog No:
Ag13709

Source:
E. coli-derived, PGEX-4T

Peptide Sequence:
QFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVKVADMESGKQIQLINRKSLRSLTAQLLVLLMSWEGDAYLPVDELRRHYETTHSTPLNPCEYGFMTLTELLKSLPYLVEVCTNDKAEEYVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYNKYVGETLQPKTYGYSSVEELLGAIPQVVWIKGHGHKRIVVLKNDMKNRLSSFDLFSVNHEDQPAVSRQILAVPESHLASELQLRTGPSQMEQELLHLASSSPVDLLCAPVPSCLPSPQLRPDPVILKPADLIQFEEHP
(1340-1652 aa encoded by NM_001081154)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top